[AlexoTech] Amyloid-Beta 1-40 (1.0 mg) Mouse, Synthetic

어스바이오는 AlexoTech 한국 공식 대리점으로서 모든 제품을 전문적으로 취급 및 공급하고 있습니다.
AlexoTech의 Amyloid-Beta 제품을 소개드립니다.
 

 

Description: Synthetic Amyloid-Beta-peptide 1-40
Article no: AB-401-10
Amount: 1mg
Format: Lyophilized
Molecular Weight: 4233 Da
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Purity: 95% HPLC and SDS-PAGE​​​​​​​
Counter Ion: TFA (Trifluoracetic Acid)​​​​​​​
Storage: Store at -20°C upon arrival.
Solubility:
Alexotech has developed a proprietary technique of preparing the Amyloid β-peptide (1-40) having a superior solubility. It is however, of utmost importance to follow our recommendations of solubilisation: To efficiently solubilise the Amyloid β-peptide (1-40) the pH should briefly be raised to between 11-12. This can be accomplished by 20 mM of NaOH, however, at high peptide concentrations a higher NaOH concentration may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using the buffer of choice.
 

---